SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060073 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060073
Domain Number 1 Region: 816-1088
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-69
Family Protein kinases, catalytic subunit 0.00000842
Further Details:      
 
Domain Number 2 Region: 506-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-42
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 3 Region: 370-474,510-535
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000007
Family SH2 domain 0.0057
Further Details:      
 
Domain Number 4 Region: 252-359
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000725
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060073   Gene: ENSMUSG00000031805   Transcript: ENSMUST00000051995
Sequence length 1100
Comment pep:known chromosome:GRCm38:8:71676296:71690575:1 gene:ENSMUSG00000031805 transcript:ENSMUST00000051995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKA
CGILPVYHSLFALATEDFSCWFPPSHIFCIEDVDTQVLVYRLRFYFPDWFGLETCHRFGL
RKDLTSAILDLHVLEHLFAQHRSDLVSGRLPVGLSMKEQGEFLSLAVLDLAQMAREQAQR
PGELLKTVSYKACLPPSLRDVIQGQNFVTRRRIRRTVVLALRRVVACQADRYALMAKYIL
DLERLHPAATTETFRVGLPGAQEEPGLLRVAGDNGISWSSGDQELFQTFCDFPEIVDVSI
KQAPRVGPAGEHRLVTVTRMDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEV
APPRLLEEEAELCHGPITLDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGP
DYKGCLIRQDPSGAFSLVGLSQPHRSLRELLAACWNSGLRVDGAALNLTSCCAPRPKEKS
NLIVVRRGCTPAPAPGCSPSCCALTQLSFHTIPTDSLEWHENLGHGSFTKIFRGRRREVV
DGETHDSEVLLKVMDSRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVY
LGAIDMYLRKRGHLVSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGGDGNP
PFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEAQTLGLEADKWGFGATTWEVFSGGPA
HITSLEPAKKLKFYEDQGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSD
YELLSDPTPGIPSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPL
GDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEY
LPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVK
IADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYC
DKSCSPSAEFLSMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHD
RPAFGTLSPQLDALWRGRPG
Download sequence
Identical sequences A0A0R4J0R7
NP_001177759.1.92730 NP_034719.2.92730 ENSMUSP00000060073 ENSMUSP00000105639 ENSMUSP00000105640 ENSMUSP00000060073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]