SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060157 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060157
Domain Number 1 Region: 501-545
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000454
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060157   Gene: ENSMUSG00000047686   Transcript: ENSMUST00000062010
Sequence length 553
Comment pep:known chromosome:GRCm38:X:106837082:106840644:-1 gene:ENSMUSG00000047686 transcript:ENSMUST00000062010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEDLAASYVTLKLENEILQAQVKRLMEENAALQAQIPELQKSGAVKEHEPLRKPSEAQE
PPESPEFPAARESQNPWEPPATTEPGEPTKIREPREPSAISELREPPEIKEPQEPPETNE
SGESSAITEFRGSPEIKEPHLPPKSKEYWGPQELPMVKESWEPPEALDSTAWKPPAVKES
QEIQKALESPATQRPQASPRGYDLPAVCEAEPTDNQGTPALKELQSPQLHNPTNDEESQT
VPEYQETSSQLEPLEHPPPQETLEPRVPQEPLDPSDAEEFLELSVPEESLEGLIVARTGT
EQAQCELEATTLPLEYPLAFSEDFQKLSEFLVQLTSYLRSRGYPTEAALVSFVGSFFSGE
AGRMFQPLLDSQPPLVEQFERLLRALQDTFDNPESLEVANQGLPQLRQGEGLAPRYSTRF
HLIAQELDLGESTLCIQFQEELASSIQNELSCTSPATNLSDVIIECVTLEEKASGGVDSS
SSSSEEENGSEGPPTENQPVQATSNRPHLSEAERARRREGHLCLYCGHPGHFARDCPVKP
HRVQQAGNMEARR
Download sequence
Identical sequences Q6P1Y1
10090.ENSMUSP00000060157 NP_955762.1.92730 ENSMUSP00000060157 ENSMUSP00000060157 ENSMUSP00000060157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]