SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060828 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060828
Domain Number 1 Region: 369-621
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-71
Family Protein kinases, catalytic subunit 0.000000000233
Further Details:      
 
Domain Number 2 Region: 146-259
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-31
Family SH2 domain 0.000000602
Further Details:      
 
Domain Number 3 Region: 11-136
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-31
Family SH2 domain 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060828   Gene: ENSMUSG00000021457   Transcript: ENSMUST00000055087
Sequence length 629
Comment pep:known chromosome:GRCm38:13:52596853:52648782:1 gene:ENSMUSG00000021457 transcript:ENSMUST00000055087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSAVDSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKA
HHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQT
VLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGAQMGHPGSPNAHPVTWSPGGIISRIKSYSFPKPGHKKP
APPQGSRPESTVSFNPYEPTGGPWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLD
RSLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLE
ESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINY
YKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMN
LCWTYDVENRPGFTAVELRLRNYYYDVVN
Download sequence
Identical sequences P48025 Q3UPF7
10090.ENSMUSP00000060828 ENSMUSP00000060828 ENSMUSP00000060828 ENSMUSP00000113852 NP_001185906.1.92730 NP_035648.2.92730 XP_006516958.1.92730 ENSMUSP00000060828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]