SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060956 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060956
Domain Number 1 Region: 8-166
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-39
Family Dual specificity phosphatase-like 0.0000000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060956   Gene: ENSMUSG00000059895   Transcript: ENSMUST00000053232
Sequence length 173
Comment pep:known chromosome:GRCm38:15:73748026:73758766:1 gene:ENSMUSG00000059895 transcript:ENSMUST00000053232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Download sequence
Identical sequences B0K032 Q9D658
10090.ENSMUSP00000060956 10116.ENSRNOP00000010224 ENSMUSP00000060956 ENSMUSP00000131281 ENSMUSP00000132097 ENSRNOP00000010224 ENSRNOP00000010224 ENSMUSP00000060956 NP_001107877.1.100692 NP_001107877.1.4139 NP_001159860.1.92730 NP_001159861.1.92730 NP_033001.2.92730 XP_006241791.1.100692 XP_006241793.1.100692 XP_006241794.1.100692 XP_006241795.1.100692 XP_006520703.1.92730 XP_006520705.1.92730 XP_008763795.1.100692 XP_008763796.1.100692 XP_011243825.1.92730 XP_017450453.1.100692 XP_017450454.1.100692 400524 ENSMUSP00000060956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]