SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062976 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062976
Domain Number 1 Region: 109-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.93e-16
Family Ovomucoid domain III-like 0.0067
Further Details:      
 
Domain Number 2 Region: 33-73
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062976   Gene: ENSMUSG00000044176   Transcript: ENSMUST00000055725
Sequence length 162
Comment pep:known chromosome:GRCm38:18:62548911:62661366:1 gene:ENSMUSG00000044176 transcript:ENSMUST00000055725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSLWSNAFVINVAIALYAETAFLSAPKLKIDCRPYLDSNDKCTREYHPVCSTSGKTY
CNKCTFCKALRLDTMSSSLLWIKITFILALVVPFYYGTTFAFSKEARRQPDCDKYRTFPN
QCTREWNPVCGTNGFTYSNECVFCNAKIAAKEKIDYRHFGPC
Download sequence
Identical sequences Q8CAC8
ENSMUSP00000062976 10090.ENSMUSP00000062976 NP_808497.1.92730 XP_006526094.1.92730 XP_006526096.1.92730 XP_006526097.1.92730 XP_006526098.1.92730 XP_011245251.1.92730 ENSMUSP00000062976 ENSMUSP00000062976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]