SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063376 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063376
Domain Number 1 Region: 37-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000139
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063376   Gene: ENSMUSG00000053729   Transcript: ENSMUST00000066328
Sequence length 90
Comment pep:known chromosome:GRCm38:18:44166358:44175073:-1 gene:ENSMUSG00000053729 transcript:ENSMUST00000066328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTWIKFLFILTLVLLPYSVFSVNIFAGPENVIKEPNCTMYKSKSECSNIAENPVCADD
RNTYYNECYFCIEKVVEKLKYRYHGICIYK
Download sequence
Identical sequences Q8CEK3
ENSMUSP00000063376 ENSMUSP00000063376 ENSMUSP00000063376 10090.ENSMUSP00000063376 NP_898946.1.92730 XP_006526415.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]