SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Mus musculus 69_38 > ENSMUSP00000066214

Domain assignment for ENSMUSP00000066214 from Mus musculus 69_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSMUSP00000066214
Domain Number 1 Region: 555-605
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.34e-16
Family Serine proteinase inhibitor lekti 0.0061
Further Details:      
 
Domain Number 2 Region: 294-344
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000152
Family Serine proteinase inhibitor lekti 0.0045
Further Details:      
 
Domain Number 3 Region: 423-469
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000194
Family Serine proteinase inhibitor lekti 0.0033
Further Details:      
 
Domain Number 4 Region: 224-271
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000277
Family Serine proteinase inhibitor lekti 0.0069
Further Details:      
 
Domain Number 5 Region: 492-542
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000305
Family Serine proteinase inhibitor lekti 0.0042
Further Details:      
 
Domain Number 6 Region: 698-745
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000527
Family Serine proteinase inhibitor lekti 0.0059
Further Details:      
 
Domain Number 7 Region: 631-679
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000638
Family Serine proteinase inhibitor lekti 0.02
Further Details:      
 
Domain Number 8 Region: 767-816
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000152
Family Serine proteinase inhibitor lekti 0.004
Further Details:      
 
Domain Number 9 Region: 863-909
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000222
Family Serine proteinase inhibitor lekti 0.036
Further Details:      
 
Domain Number 10 Region: 159-207
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000402
Family Serine proteinase inhibitor lekti 0.0083
Further Details:      
 
Domain Number 11 Region: 941-997
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000554
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 12 Region: 366-411
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000943
Family Serine proteinase inhibitor lekti 0.0021
Further Details:      
 
Domain Number 13 Region: 95-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000208
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 14 Region: 26-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000116
Family Serine proteinase inhibitor lekti 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066214   Gene: ENSMUSG00000055561   Transcript: ENSMUST00000069245
Sequence length 1017
Comment pep:known chromosome:GRCm38:18:43963235:44022501:1 gene:ENSMUSG00000055561 transcript:ENSMUST00000069245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MKTATVPMLLTLAFYLTQDAAGEKGNQDPCMKFQAQMKNGTLTCPKGNNSSQSLNDIIFQ
SECILCKRALEQGAPTKIMNVKVLSRANRATDPAKLNCESFKQRRKDGDFICPSDTSSVC
GTDGKTYRSRCELCAENAKSQNHVDVKSEGECGSSHLETDMCSDFRAYVQDGRLGCTRES
DPILGPDGRTHGNRCAMCAELFLKEAKENATRNRESRIRRDAEKELCKEFENQVRNGRLF
CTRESDPIRGPDGKMHGNKCALCAEIFMRQFTEEKGKAEKNQKDAEERAKAKMEIQKRCS
EFQDRARNGTLFCTRENDPIRGLDGKTHGNLCSMCQAFFKTEAEEKKAEAGSRNRRGSEE
SETYAKLCDEYRKARKNGQLYCTRENAPIRGPDGKIHGNTCSMCQAFFIQEDKARAKVKR
EAAKEMCSEFRNQARNGMLMCTRENDPVVGPDGKRHSNKCAMCASVFLLEEEEKKKDDKT
EKVDAGKAKKEAVQELCRKYHTQLRNGPLRCTRRNNPIEGLDGKMYKNACFMCWAFFQQE
AKKSGAGFRPKVKREVKVDCSEYLALSKRGEIFCTRENDPVRGPDGKTHGNKCAMCKAVF
KKENEERKRKEGENQRITSGESSSGGNPKAKDECAQYRESMKHGQLSCTRESDPVRGVDG
EHYNNKCVMCKELLQKEMEETNKNSASRSNGTGSATGKDVCDQFRSQMKNGKLLCTRESD
PTRGPDGAMHGNKCAMCKERLEKEAAEKKKKEDEEKRNTETNKSDKEDKCHEYRSMQLDG
RLICTRENDPVRDADGKMHVNKCAMCQMMFEREANERKMREENSRSQPTNEAKDQCGEVH
NSVEDAKPRPARSSLPSIRGISKDECSEFQNLMKNEKLTCPETDDPVRGADGTFYQNKCH
MCRDVLKNEAMKRSGLQEKSSDIRSTKEGDPEFSSSSRDSDMCKNYRILPRMGYLCPKNL
NPVCGDDGQTYSNPCMLCHENLMRQTNTRIHKQGACEESSNLKTVSTGTPASEKMMQ
Download sequence
Identical sequences Q148R4
ENSMUSP00000066214 ENSMUSP00000066214 ENSMUSP00000066214 10090.ENSMUSP00000066214 NP_001074649.1.92730 XP_006526342.1.92730 XP_006526343.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.