SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067117 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067117
Domain Number 1 Region: 37-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000333
Family Ovomucoid domain III-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067117   Gene: ENSMUSG00000053030   Transcript: ENSMUST00000065216
Sequence length 86
Comment pep:known chromosome:GRCm38:5:77205107:77211471:-1 gene:ENSMUSG00000053030 transcript:ENSMUST00000065216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLVLLLLVTDFAASHETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNT
YSNECTLCMKIREDGSHINIIKDEPC
Download sequence
Identical sequences Q8BMY7
ENSMUSP00000067117 NP_899107.1.92730 10090.ENSMUSP00000067117 ENSMUSP00000067117 ENSMUSP00000067117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]