SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069231 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069231
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-38
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 4.08e-36
Family Link domain 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069231   Gene: ENSMUSG00000053475   Transcript: ENSMUST00000065927
Sequence length 275
Comment pep:known chromosome:GRCm38:2:52038009:52056686:1 gene:ENSMUSG00000053475 transcript:ENSMUST00000065927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLLCLCVLLWEEAHGWGFKNGIFHNSIWLEQAAGVYHREARAGRYKLTYAEAKAVCEF
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDF
DLEHDPGCLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVTVDPASKSSQAKNTSTTGNKKFLPGRFSHL
Download sequence
Identical sequences O08859 Q3USX6
ENSMUSP00000069231 ENSMUSP00000069231 NP_033424.1.92730 ENSMUSP00000069231 10090.ENSMUSP00000069231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]