SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000070575 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000070575
Domain Number 1 Region: 26-194
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-44
Family Dual specificity phosphatase-like 0.000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000070575   Gene: ENSMUSG00000037628   Transcript: ENSMUST00000067426
Sequence length 211
Comment pep:known chromosome:GRCm38:14:46760541:46771525:1 gene:ENSMUSG00000037628 transcript:ENSMUST00000067426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPISIQASEFDSSDEEPVDEEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNI
QKDTEELKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDIGSCW
EIMEELATCLKNNRKTLIHCYGGLGRSCLAACLLLYLSDSISPQQAIDSLRDVRGSGAIQ
TIKQYNYLHEFRDKLAAYLSSRDSLSRSVSR
Download sequence
Identical sequences Q810P3
ENSMUSP00000070575 ENSMUSP00000070575 10090.ENSMUSP00000070575 NP_082498.1.92730 ENSMUSP00000070575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]