SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075551 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075551
Domain Number 1 Region: 30-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000638
Family Ovomucoid domain III-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075551   Gene: ENSMUSG00000060201   Transcript: ENSMUST00000076194
Sequence length 85
Comment pep:known chromosome:GRCm38:18:62592413:62596264:-1 gene:ENSMUSG00000060201 transcript:ENSMUST00000076194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVGGLLLLFAATYVCNCSEVTSHPSATVDCDIYKKYPVVAIPCPIVNIPVCGSDYITY
GNKCKLCTEILRSNGKIQFLHEGHC
Download sequence
Identical sequences F8WGH2
ENSMUSP00000075551 ENSMUSP00000075551 NP_001001803.2.92730 ENSMUSP00000075551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]