SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079733 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079733
Domain Number 1 Region: 549-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-81
Family Protein kinases, catalytic subunit 0.00000101
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-55
Family FCH domain 0.0042
Further Details:      
 
Domain Number 3 Region: 440-578
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079733   Gene: ENSMUSG00000053158   Transcript: ENSMUST00000080932
Sequence length 822
Comment pep:known chromosome:GRCm38:7:80377758:80387946:-1 gene:ENSMUSG00000053158 transcript:ENSMUST00000080932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
WSSGPDSPVSQSWAEITSQTENLSRVLRQHAEDLNSGPLSKLSVLIRERQHLRKTYNEQW
QQLQQELTKTHSQDIEKLKTQYRTLVRDSTQARRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHHHHHRFMLPGLLQSLQDLHEEMAGILKDILQEYLEISSLVQDD
VASIHRELAAAAARIQPEFEYLGFLRQYGSTPDVPPCVTFDESLLEDGEQLEPGELQLNE
LTLESVQHTLTSVTDELAVATKEVLSRQEMVSQLQRELQSEEQNTHPRERVQLLSKRQML
QEAIQGLQIALCSQDKLQAQQELLQSKMEQLGTGEPPAVPLLQDDRHSTSSTEQEREGGR
TPTLEILKSHFSGIFRPKFSIPPPLQLVPEVQKPLYEQLWYHGAIPRAEVAELLTHSGDF
LVRESQGKQEYVLSVMWDGQPRHFIIQSSDNLYRLEGDGFPSIPLLITHLLSSQQPLTKK
SGVVLFRAVPKDKWVLKHEDLVLGEQIGRGNFGEVFSGRLRADNTPVAVKSCRETLPPDL
KAKFLQEARILKQYNHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGIYAASAGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLTNQQTREFVEKGHRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSIICQELHSIRKRHR
Download sequence
Identical sequences P16879
ENSMUSP00000079733 10090.ENSMUSP00000079733 NP_034324.2.92730 XP_006540667.1.92730 ENSMUSP00000079733 ENSMUSP00000079733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]