SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080025 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080025
Domain Number 1 Region: 46-93
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 9.84e-16
Family Ovomucoid domain III-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080025   Gene: ENSMUSG00000061144   Transcript: ENSMUST00000081271
Sequence length 105
Comment pep:known chromosome:GRCm38:18:44104407:44108543:1 gene:ENSMUSG00000061144 transcript:ENSMUST00000081271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNAPNISVFSDLKILSAMKPAGAFLLLISLACLFLSVDAVSQGGFQAFCSNYEKTLAPD
GKSCPKTHKPVCGTDGKTYQNRCAFCQTAMERSLGKLGFKHEGKC
Download sequence
Identical sequences A0A0R4J109
ENSMUSP00000080025 10090.ENSMUSP00000080025 ENSMUSP00000080025 NP_084337.1.92730 ENSMUSP00000080025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]