SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082855 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082855
Domain Number 1 Region: 317-566
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.06e-86
Family STAT DNA-binding domain 0.000000628
Further Details:      
 
Domain Number 2 Region: 137-316
Classification Level Classification E-value
Superfamily STAT 1.88e-45
Family STAT 0.00018
Further Details:      
 
Domain Number 3 Region: 567-683
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-39
Family SH2 domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 1-123
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.14e-33
Family Transcription factor STAT-4 N-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082855   Gene: ENSMUSG00000040033   Transcript: ENSMUST00000085708
Sequence length 923
Comment pep:known chromosome:GRCm38:10:128270576:128292849:1 gene:ENSMUSG00000040033 transcript:ENSMUST00000085708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSLFLDQLHQVYSQSILPMDVRQHLATWIEDQNWREAALGSDDAKANMLY
FSILDQLNQWDHYSSDSNHFLLQHNLRKFSRDIQTFPNGPTQLAEMIFNLLLEEQRILNQ
AQRAQEVQPPPAPEAVVESQQLEIENRIQGLHVDIEFLVRSIRQLKDEQDVFSFRYTVFS
LKKTSSSDPHQSQQAQLVQATANKVDRMRKEVLDISKGLVGRLTTLVDLLLPKLDEWKVQ
QQKSCIGAPPPELQLEQLEQWLTAGAKFLFHLRQLLKQLKEMSHMLRYKGDMFGQGVDLQ
NAQVMELLQRLLQRSFVVETQPCMPQTLHRPLILKTGNKFTVRTRLLVRLQEGSESLKAE
VSVDRNSDLPGFRKFNILTSNQKTLTPEEGQRQGLIWDFGFLTLVEQRAVGAGKGNKQGP
LAVTEELHVISFVVEYVYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSPNPKN
QQFFCQAPKAPWSLLGPVLSWQFSSYVGRGLDSEQLGMLRTKLFGKSCKMEDALLSWVDF
CKRESPPGKIPFWTWLDKILELVHDHLKDLWKDGRIMGFVSRNQERRLLKKMLSGTFLLR
FSETSEGGITCSWVEHQDDDKVEIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENIPENPL
RFLYPRIPRDEAFGCYYQEKVNFEEQRKYLKHKLIVISNRQVDELQQPLELKQDSESLEV
NAELLLAHDQELPLMMQTGLVLGTELKVDPILSTAPQVLLEPAPQVLLEPAPQVPLEPAP
QVLLEPAPQVLLEPAPQVLLEPAPQVLLEPAPQVQLEPAPQVLLELAPQVLLEPAPQVLL
ELAPQVQLEPAHLLQQPSESDLPEDLQQISVEDLKKLSNPSTEYITTNENPMLAGESSGD
ETSIPYHSHFDADGLLGWTLDTF
Download sequence
Identical sequences E9QJX9
ENSMUSP00000100872 10090.ENSMUSP00000100872 ENSMUSP00000082855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]