SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000085862 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000085862
Domain Number 1 Region: 22-276
Classification Level Classification E-value
Superfamily DNase I-like 4.71e-40
Family DNase I-like 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000085862   Gene: ENSMUSG00000024136   Transcript: ENSMUST00000088506
Sequence length 278
Comment pep:known chromosome:GRCm38:17:24440087:24443105:-1 gene:ENSMUSG00000024136 transcript:ENSMUST00000088506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWPWAPLTAVWALGVMGATALRIGAFNVQSFGDNKVSDPDCGSVIAQILAGYDIALVQE
VRDPDLSAVSLLMEQINRVSKHEYGFVSSKPLGRDQYKEMYLFVYRKDVASVVSTYQYPD
PEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDALYDVYLDVIDKWNTDDML
FLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVVSGAHLRRS
LKPHSASVHNFQEEFDLDQTQALAISDHFPVEVTFKTH
Download sequence
Identical sequences Q9D1G0
10090.ENSMUSP00000085862 NP_079994.2.92730 ENSMUSP00000085862 ENSMUSP00000113508 ENSMUSP00000085862 ENSMUSP00000085862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]