SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087117 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087117
Domain Number 1 Region: 188-305
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-20
Family SH2 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087117   Gene: ENSMUSG00000052631   Transcript: ENSMUST00000089687
Sequence length 323
Comment pep:known chromosome:GRCm38:6:72513654:72520538:-1 gene:ENSMUSG00000052631 transcript:ENSMUST00000089687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKPPSSLCHQHPFLKAQEEGEEEDKYELPPCEVLPVSLAPAQSLGSKDDSLYLDRSGPL
DPSKPPLPPPQSTMARGLPINPSFPTRPTSGYHFPLKTAMNPQPAKQGPVFGRQGRGTSA
RMVTKKPDEDIYLECEPDPVPVLTRSLSSKALIPPVPLPRTSGLPKSVAGYQEARNGAMD
GALKAGRRLSASSIAPALSSSVAENGSLLGQPWYSGNCDRQSVERALLHFQKDGAYTVRL
SSGPHSSQPFTLAVLLRGRVFNIPIRQLDGGHHYALGREGRNHEELFSSVAAMVQHYTKH
PLPLVDGHSGNRGLTYLRFPTKP
Download sequence
Identical sequences E2QRQ0
ENSMUSP00000124673 ENSMUSP00000124673 ENSMUSP00000087117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]