SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089535 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089535
Domain Number 1 Region: 39-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000208
Family Ovomucoid domain III-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089535   Gene: ENSMUSG00000069385   Transcript: ENSMUST00000091916
Sequence length 85
Comment pep:known chromosome:GRCm38:18:44156404:44159303:-1 gene:ENSMUSG00000069385 transcript:ENSMUST00000091916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIFSRVQVIYITLSFLLFSESHFIRRAIYKHIVMCRGFSSKRICTREYFPVCATNGRTY
FNKCIFCLAYRENDGSFIMSHLGKC
Download sequence
Identical sequences Q6IE31
ENSMUSP00000089535 ENSMUSP00000089535 ENSMUSP00000089535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]