SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093141 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093141
Domain Number 1 Region: 188-284
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-21
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 409-546
Classification Level Classification E-value
Superfamily TIMP-like 2.51e-21
Family Netrin-like domain (NTR/C345C module) 0.017
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily BPTI-like 5.53e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 4 Region: 109-159
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000025
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 311-356
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000468
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.022
Further Details:      
 
Domain Number 6 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.000000249
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093141   Gene: ENSMUSG00000071192   Transcript: ENSMUST00000095487
Sequence length 552
Comment pep:known chromosome:GRCm38:17:25877630:25880305:-1 gene:ENSMUSG00000071192 transcript:ENSMUST00000095487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPQPFLPLLFVFVLIHLTSETNLLPDPGSHPGMCPNELSPHLWVDAQSTCERECTGDQ
DCAASEKCCTNVCGLQSCVAARFPSGGPAVPETAASCEGFQCPQQGSDCDIWDGQPVCRC
RDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHVVPCKHILSWPPSSPGPPETTAR
PTPGAAPMPPALYNSPSPQAVHVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQM
YGNVVVTSIGQLVLYNAQLEDAGLYTCTARNAAGLLRADFPLSVLQRATTQDRDPGIPAL
AECQADTQACVGPPTPHHVLWRFDPQRGSCMTFPALRCDGAARGFETYEACQQACVRGPG
DVCALPAVQGPCQGWEPRWAYSPLLQQCHPFVYSGCEGNSNNFETRESCEDACPVPRTPP
CRACRLKSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALDDVLKDDKMGLKFLGTK
YLEVTLSGMDWACPCPNVTAVDGPLVIMGEVREGVAVLDANSYVRAASEKRVKKIVELLE
KKACELLNRFQD
Download sequence
Identical sequences Q8R0S6
ENSMUSP00000093141 ENSMUSP00000093141 NP_001093924.1.92730 ENSMUSP00000093141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]