SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000094153 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000094153
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-39
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000094153   Gene: ENSMUSG00000071748   Transcript: ENSMUST00000096420
Sequence length 223
Comment pep:known chromosome:GRCm38:X:68821093:68825318:1 gene:ENSMUSG00000071748 transcript:ENSMUST00000096420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVKLEFPSLPQCKDDAEEWTYPMRREMQEVLPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQNGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLAVHSGTTGSVKRTHEEDDDFGNMQVATAQNG
Download sequence
Identical sequences Q60969
NYSGXRC-8698b ENSMUSP00000094153 ENSMUSP00000107466 10090.ENSMUSP00000093646 10090.ENSMUSP00000094153 NP_062611.2.92730 ENSMUSP00000094153 ENSMUSP00000107466 ENSMUSP00000094153 ENSMUSP00000107466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]