SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095165 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095165
Domain Number 1 Region: 35-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000819
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095165   Gene: ENSMUSG00000073551   Transcript: ENSMUST00000097557
Sequence length 97
Comment pep:known chromosome:GRCm38:18:62607540:62741387:-1 gene:ENSMUSG00000073551 transcript:ENSMUST00000097557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSGCWHQRMLLSLVLLTWTHVTFSALIRSHNFSRWPKPPCKMYYPIDPDYEANCPDVK
AYVCATNGLTYKNECFFCIDRWEFGPHIQFVKYGKCE
Download sequence
Identical sequences Q3UTS8
NP_001161895.1.92730 10090.ENSMUSP00000095165 ENSMUSP00000095165 ENSMUSP00000095165 ENSMUSP00000095165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]