SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095193 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095193
Domain Number 1 Region: 45-89
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000541
Family Ovomucoid domain III-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095193   Gene: ENSMUSG00000073572   Transcript: ENSMUST00000097586
Sequence length 90
Comment pep:known chromosome:GRCm38:18:44201264:44206018:1 gene:ENSMUSG00000073572 transcript:ENSMUST00000097586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFDKISPIWVRSLFILNVVFPPYFVAETAVAHLRRLFKVPNCEPYRSVTICLDTLNPVCG
DDGKSYDNHCYFCTETFRKNLSYKHHGVCT
Download sequence
Identical sequences F6XDR3
ENSMUSP00000095193 ENSMUSP00000095193 ENSMUSP00000095193 10090.ENSMUSP00000095193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]