SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095194 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095194
Domain Number 1 Region: 70-112
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000139
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095194   Gene: ENSMUSG00000073573   Transcript: ENSMUST00000097587
Sequence length 114
Comment pep:known chromosome:GRCm38:18:44190045:44196177:-1 gene:ENSMUSG00000073573 transcript:ENSMUST00000097587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNEVEEQTVSTECWYIFISVFRFDKMSSTWIKFLFILTLVLLPYFVAESAVASPESLRK
VPNCTLYKSESDCSRTLIPVCADNQMTYYNACYFCLEQLVSPIKYKYHGICTKE
Download sequence
Identical sequences A0A0R4J158
NP_001041682.2.92730 ENSMUSP00000095194 ENSMUSP00000095194 10090.ENSMUSP00000095194 ENSMUSP00000095194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]