SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100729 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000100729
Domain Number - Region: 46-98
Classification Level Classification E-value
Superfamily Cupredoxins 0.0191
Family Nitrosocyanin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100729   Gene: ENSMUSG00000078306   Transcript: ENSMUST00000105102
Sequence length 104
Comment pep:known chromosome:GRCm38:9:57148180:57151937:1 gene:ENSMUSG00000078306 transcript:ENSMUST00000105102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSESGLSGQLKQASLVYAAVLHSRLAGPRASEQLSRLHLPSPSPFKRSFEVLDAGYNM
GFPPQKANASTPEPSCWPVLTVLVTNQGVYFIFCSLICPCSYSQ
Download sequence
Identical sequences Q8C6W7
ENSMUSP00000100729 ENSMUSP00000100729 10090.ENSMUSP00000100729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]