SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101449 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101449
Domain Number 1 Region: 15-146
Classification Level Classification E-value
Superfamily PH domain-like 1.33e-24
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 2 Region: 273-391
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000512
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101449   Gene: ENSMUSG00000045349   Transcript: ENSMUST00000105823
Sequence length 429
Comment pep:known chromosome:GRCm38:4:138250464:138261332:1 gene:ENSMUSG00000045349 transcript:ENSMUST00000105823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAGAGARRASDCGPAPYRPRCIAKLAQYVGSFPVDDLDTQESVGLVQQQLWALQDCSR
RRAVILKFSLQGLKIYSGEGEVLLMAHALKRILYATWYPAACQFAFIARNPRSPSSKLFC
HLFVGSQPGEVHILYLLLCRSFQLAYLLQHPEERAQSEPCLAPVGDLSLKPLCSPGVPPA
LVREPFSRDQLSQNVHALVSFRRLPAEGLLGSNGKELPESEGRGGTRHIRLGNPYCSPTL
VRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGPSCLVENEGSLTEN
IWAFAGLSRSCALSLLRRDVHGAFLLWPEPGTSDQWSLSVRTQCGVVPHQVFRNHLGRFC
LEHLPAEFPSLEALVESHAGVERSLFCPLSMGRLNPTYEEQDCGTEGRFPRTLRPLSHAK
SEAELQGLG
Download sequence
Identical sequences A2AM67 Q8JZW5
NP_001093101.1.92730 ENSMUSP00000101449 ENSMUSP00000101449 ENSMUSP00000101450 ENSMUSP00000101449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]