SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102790 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102790
Domain Number 1 Region: 45-207
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-46
Family Dual specificity phosphatase-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102790   Gene: ENSMUSG00000003518   Transcript: ENSMUST00000107172
Sequence length 210
Comment pep:known chromosome:GRCm38:11:101971143:101987013:-1 gene:ENSMUSG00000003518 transcript:ENSMUST00000107172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMGCGTIRYLYSLCYDSVKRPAAAMSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVP
RVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDTQE
FNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSTVR
QNREIGPNDGFLAQLCQLNDRLAKEGKVKL
Download sequence
Identical sequences B1AQF4
ENSMUSP00000102791 10090.ENSMUSP00000102791 ENSMUSP00000102790 ENSMUSP00000102791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]