SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107087 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107087
Domain Number 1 Region: 98-253
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-32
Family Dual specificity phosphatase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107087   Gene: ENSMUSG00000063235   Transcript: ENSMUST00000111461
Sequence length 260
Comment pep:known chromosome:GRCm38:2:90910726:90918258:-1 gene:ENSMUSG00000063235 transcript:ENSMUST00000111461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVPGSLGQGRDSGDSASKSREASGGPQLSSSASFSRWLVASPGAGGWPLRLAGWGASP
LRLAGWGGMAASAWLEAGLARVLFYPTLLYTVSGRVRGPAHRDWYHRIDHTVLLGALPLK
NMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHK
GVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRP
SQLEVLKEFHKEITARAAKN
Download sequence
Identical sequences ENSMUSP00000107087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]