SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107882 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107882
Domain Number 1 Region: 376-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.000000015
Further Details:      
 
Domain Number 2 Region: 8-149
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-44
Family Pleckstrin-homology domain (PH domain) 0.0000531
Further Details:      
 
Domain Number 3 Region: 271-417
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-33
Family SH2 domain 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107882   Gene: ENSMUSG00000031377   Transcript: ENSMUST00000112263
Sequence length 655
Comment pep:known chromosome:GRCm38:X:164193355:164250368:-1 gene:ENSMUSG00000031377 transcript:ENSMUST00000112263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDNMESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIE
IKKIRCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHL
LIKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHIAISDEKHRAPTFPERLLKIPRA
VPVLKMDASSSGAILPQYDSYSKKSCGSQPTSNIRYIPREDCPDWWQVRKLKSEEDIACS
NQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRSQSEQLLRQKGKEGAFM
VRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHN
SAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELGNGQFGVVQLGQWKGQY
DVAVKMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNY
LKSHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRY
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSE
VVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSAIEPLREQDKP
Download sequence
Identical sequences B1AUL6
ENSMUSP00000107884 ENSMUSP00000107884 ENSMUSP00000107882 NP_033889.2.92730 10090.ENSMUSP00000107884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]