SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108560 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108560
Domain Number 1 Region: 4-232
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.97e-57
Family Adenylyltransferase 0.00000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108560   Gene: ENSMUSG00000032456   Transcript: ENSMUST00000112938
Sequence length 245
Comment pep:known chromosome:GRCm38:9:98296604:98420527:1 gene:ENSMUSG00000032456 transcript:ENSMUST00000112938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGIISPVNDSYGKKDLVA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHRELLRSSAQMDGPDPSKTP
SASAALPELKLLCGADVLKTFQTPNLWKDTHIQEIVEKFGLVCVSRSGHDPERYISDSPI
LQQFQHNIHLAREPVLNEISATYVRKALGQGQSVKYLLPEAVITYIRDQGLYINDGSWKG
KGKTG
Download sequence
Identical sequences Q99JR6
10090.ENSMUSP00000035031 ENSMUSP00000035031 NP_653116.1.92730 XP_006511565.1.92730 XP_006511566.1.92730 XP_006511567.1.92730 XP_011241128.1.92730 XP_011241129.1.92730 ENSMUSP00000108557 ENSMUSP00000108560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]