SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112480 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112480
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.08e-27
Family DnaQ-like 3'-5' exonuclease 0.000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112480   Gene: ENSMUSG00000039236   Transcript: ENSMUST00000118867
Sequence length 300
Comment pep:known chromosome:GRCm38:7:78913424:78920212:1 gene:ENSMUSG00000039236 transcript:ENSMUST00000118867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIPEVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRPEGEITDYRTQVSGVT
PQHMVRATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSKYTIYDTSTDRLLWHEA
KLQYYSRVSLRLLCKRLLHKNIQVLPGSLLGVGGCILPGTDILHLLLYVGMVRIADLRLL
TPFLPPSCLACPLLPESLASARSHAVISALSSSSHLLTPLPNPSQGPQGHVDRLSGQLQD
WGGSPLAPALPVSAEQLAGPLLCGRCQGHNGALQNLSATQSPARAALPWDVRLNFILIQG
Download sequence
Identical sequences Q9JL16
NP_001278149.1.92730 XP_006541089.1.92730 XP_006541091.1.92730 ENSMUSP00000040606 ENSMUSP00000112480 10090.ENSMUSP00000112621 ENSMUSP00000112621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]