SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112990 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112990
Domain Number 1 Region: 34-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000152
Family Ovomucoid domain III-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112990   Gene: ENSMUSG00000050074   Transcript: ENSMUST00000118732
Sequence length 105
Comment pep:known chromosome:GRCm38:9:109816627:109826628:1 gene:ENSMUSG00000050074 transcript:ENSMUST00000118732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVIFSVAVLVLASSVWTSLAVDFILPMNFHMTGELLQKTKALCIKNIQLCWILSYFKVS
EPICGSNQVTYEGECHLCSGILYEDRTVIKVHDGPCEHSSDESEH
Download sequence
Identical sequences Q09TK9
ENSMUSP00000052529 NP_898959.2.92730 XP_006512461.1.92730 10090.ENSMUSP00000052529 ENSMUSP00000112990 ENSMUSP00000052529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]