SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114188 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114188
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-83
Family Protein kinases, catalytic subunit 0.000000000633
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114188   Gene: ENSMUSG00000019843   Transcript: ENSMUST00000146287
Sequence length 537
Comment pep:known chromosome:GRCm38:10:39454915:39564355:1 gene:ENSMUSG00000019843 transcript:ENSMUST00000146287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences P39688
10090.ENSMUSP00000097547 ENSMUSP00000097547 ENSMUSP00000097547 NP_001116365.1.92730 XP_006512602.1.92730 XP_006512603.1.92730 XP_006984366.1.50099 XP_011241419.1.92730 XP_015858279.1.50099 XP_021060448.1.100879 ENSMUSP00000114188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]