SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115965 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115965
Domain Number 1 Region: 182-334
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.41e-43
Family Cap-Gly domain 0.0000000867
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.1e-34
Family Cap-Gly domain 0.00000299
Further Details:      
 
Domain Number 3 Region: 837-932
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000889
Family Myosin rod fragments 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000115965
Domain Number - Region: 1398-1432
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00698
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115965   Gene: ENSMUSG00000049550   Transcript: ENSMUST00000149410
Sequence length 1437
Comment pep:known chromosome:GRCm38:5:123617706:123666690:-1 gene:ENSMUSG00000049550 transcript:ENSMUST00000149410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLKPSGLKAPTKILKPGSTALKTPAAAAAPVEKTIPSEKASGPPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQAAPGRTASPLSTAAATMVSSSPATPSNIPHKPSQSTAKEPSA
TPQISNLTKTASESISNLSEAGSVKKGERELKVGDRVLVGGTKAGVVRFLGETDFAKGEW
CGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKAAAVRRVMA
ATPASLKRSPSASSLSSMSSVASSVSSKPSRTGLLTETSSRYARKISGTTALQEALKEKQ
QHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAAD
REKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSPISEDPENTQTKLEHARTKELE
QSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRAQEVAELRRRLESSKPPGD
VDMSLSLLQEISALQEKLEAIHTDHQGEMTSLKEHFGAREEAFQKEIKALHTATEKLSKE
NESLRSKLDHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGIGTDSAEFAELKT
QIERLRLDYQHEIESLQSKQDSERSAHAKEMETMQAKLMKIIKEKEDSLEAVKARLDSAE
DQHLVEMEDTLNKLQEAEIKVKELEVLQAKYTEQSEVIGNFTSQLSAVKEKLLDLDALRK
ANSEGKLELETLRQQLEGAEKQIKNLETERNAESSKANSITKELQEKELVLTGLQDSLNQ
VNQVKETLEKELQTLKEKFASTSEEAVSAQTRMQDTVNKLHQKEEQFNVLSSELEKLREN
LTDMEAKFKEKDDREDQLVKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERSVEEL
QLKLTKANENASFLQKSIGEVTLKAEQSQQQAARKHEEEKKELEEKLLELEKKMETSYNQ
CQDLKAKYEKASSETKTKHEEILQNLQKMLADTEDKLKAAQEANRDLMQDMEELKTQADK
AKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNARLQNELDTLKENNLKTVEELNKSK
ELLSVENQKMEEFKKEIETLKQAAAQKSQQLSALQEENVKLAEELGRTRDEVTSHQKLEE
ERSVLNNQLLEMKKRESEFRKDADEEKASLQKSISLTSALLTEKDAELEKLRNEVTVLRG
ENATAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDAQAEEDERAQES
QIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGEDLNSYDSDDQEKQSKKKPRLFCDI
CDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRSEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences F8WIA1
ENSMUSP00000031382 ENSMUSP00000115965 ENSMUSP00000031382 XP_006530484.1.92730 10090.ENSMUSP00000031382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]