SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123177 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123177
Domain Number 1 Region: 58-185
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-23
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 503-609
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000484
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123177   Gene: ENSMUSG00000054520   Transcript: ENSMUST00000125817
Sequence length 615
Comment pep:known chromosome:GRCm38:5:34525838:34551700:1 gene:ENSMUSG00000054520 transcript:ENSMUST00000125817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSGSRPRSWGWRETGSRDEAAAGGPTSGPCRCSQGRRALAAPRKPAVPAAWTPFMAAE
EMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCIYYFKSS
TSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEDERKSWMAL
LRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDISLSSYPMDNEDYEHEDEDDSYL
EPDSPGPMKLEDALTYPPAYPPPPVPVPRKPAFSDLPRAHSFTSKSPSPLLPPPPPKRGL
PDTGSAPEDAKDALGLRRVEPGLRVPATPRRMSDPPMSNVPTVPNLRKHPCFRDSVNPGL
EPWTPGHGTSSVSSSTTMAVATSRNCDKLKSFHLSSRGPPTSEPPPVPANKPKFLKIAEE
PSPREAAKFAPVPPVAPRPPVQKMPMPEATVRPAVLPRPENTPLPHLQRSPPDGQSFRGF
SFEKARQPSQADTGEEDSDEDYEKVPLPNSVFVNTTESCEVERLFKATDPRGEPQDGLYC
IRNSSTKSGKVLVVWDESSNKVRNYRIFEKDSKFYLEGEVLFASVGSMVEHYHTHVLPSH
QSLLLRHPYGYAGPR
Download sequence
Identical sequences E9QJU7
10090.ENSMUSP00000112554 NP_001139331.1.92730 ENSMUSP00000112554 ENSMUSP00000123177 ENSMUSP00000112554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]