SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124542 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124542
Domain Number 1 Region: 228-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124542
Domain Number - Region: 338-362
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 298-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00663
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124542   Gene: ENSMUSG00000035649   Transcript: ENSMUST00000142714
Sequence length 541
Comment pep:known chromosome:GRCm38:4:44756647:44909816:1 gene:ENSMUSG00000035649 transcript:ENSMUST00000142714 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCEN
SETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAEEKTQSPAT
SHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESWMLLGSEE
DGKDNDILLNLVGCETAGAEDDVNWFISDKDIEAKIDNNRSSGRWNNRYYSVNKNVTCRN
CDKRGHLSKNCPLPQKVRACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKR
CDRCDMIGHHADACPEIWRQYHLTTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGHECTE
RRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKDLKKNGDFPRQFKRPHVEETDKRRH
HDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCA
NNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKSTEDGSHDDLFLIKQKKKKPKPSG
L
Download sequence
Identical sequences B1AX39
NP_613056.2.92730 XP_006538047.1.92730 ENSMUSP00000124542 ENSMUSP00000103454 ENSMUSP00000103454 10090.ENSMUSP00000068285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]