SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124966 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124966
Domain Number 1 Region: 224-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000142
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 144-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124966
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00105
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124966   Gene: ENSMUSG00000029625   Transcript: ENSMUST00000162244
Sequence length 269
Comment pep:known chromosome:GRCm38:5:145167254:145181753:1 gene:ENSMUSG00000029625 transcript:ENSMUST00000162244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPTKQSNNPPLQRSSSLIQLTSQNSSPNQQRAPQVIGVMQSQNSSAGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Download sequence
Identical sequences A0A1A6G444 A0A1S3AK12 A0A1U7R2Y8 A0A287D9Y7 E0CXT7 F7DCT2 G1LI40 L5KIZ1 M3YYJ5
ENSAMEP00000006588 ENSMUSP00000125019 XP_001494963.1.31192 XP_003470065.1.53824 XP_003998510.1.62641 XP_004394250.1.74151 XP_004440895.1.5094 XP_004629699.1.9945 XP_004692006.1.23501 XP_004774997.1.14098 XP_005079970.1.91757 XP_005339792.1.77405 XP_005368120.1.66349 XP_006248931.1.100692 XP_006504908.1.92730 XP_006748327.1.47382 XP_006913413.1.64745 XP_007536343.1.11023 XP_007615090.1.28591 XP_007648507.1.69978 XP_008139597.1.99482 XP_008696584.1.72690 XP_011229321.1.58354 XP_011383905.1.92234 XP_014711463.1.49734 XP_015856727.1.50099 XP_016073265.1.3490 XP_019278179.1.44245 XP_020017327.1.5219 XP_021042895.1.100879 ENSMPUP00000016405 ENSMPUP00000016405 ENSAMEP00000006588 9796.ENSECAP00000005770 ENSECAP00000005770 ENSECAP00000005770 ENSSTOP00000001512 ENSMUSP00000125019 ENSSTOP00000001512 ENSFCAP00000013979 ENSMUSP00000124966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]