SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125121 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125121
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-28
Family SH2 domain 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125121   Gene: ENSMUSG00000073494   Transcript: ENSMUST00000162752
Sequence length 132
Comment pep:known chromosome:GRCm38:1:170232749:170253608:1 gene:ENSMUSG00000073494 transcript:ENSMUST00000162752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKN
GYYRIETEPSTPKTIFPNLEELISKFKTPGQGMVVHLSNPIMRSGFCPGARRLNLEANVY
ENTDEEYVDVLP
Download sequence
Identical sequences Q45HK4
ENSMUSP00000125121 10090.ENSMUSP00000095078 ENSMUSP00000125121 ENSMUSP00000125121 NP_001028671.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]