SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128123 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128123
Domain Number 1 Region: 17-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000261
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128123
Domain Number - Region: 130-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000335
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128123   Gene: ENSMUSG00000028772   Transcript: ENSMUST00000167964
Sequence length 241
Comment pep:known chromosome:GRCm38:4:130316085:130359943:-1 gene:ENSMUSG00000028772 transcript:ENSMUST00000167964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVVIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPEEEEEKEEAKAEGLEKPDPTK
NSSRKRKKEKKKKKHRDRKSSDCDSSDSESDTGKKARHSSKDSKATKKKKKKKKHKKKHK
E
Download sequence
Identical sequences Q3TG23 Q9ESX4
ENSMUSP00000128123 10090.ENSMUSP00000101617 NP_694800.1.92730 ENSMUSP00000120807 ENSMUSP00000128123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]