SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136875 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136875
Domain Number 1 Region: 117-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000136875
Domain Number - Region: 165-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0017
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number - Region: 202-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0223
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136875   Gene: ENSMUSG00000096330   Transcript: ENSMUST00000180066
Sequence length 239
Comment pep:known chromosome:GRCm38:13:98279938:98307154:1 gene:ENSMUSG00000096330 transcript:ENSMUST00000180066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEKEVANCRSAGIKGVPRTGSIVHQSPGLPGFMAAHRVHPQGQATGVSFLPTAADVPLDR
HRKKGHSCLPTRKCLLTSCGVFLVLGVVAAAIAVGIIFGTPTKPASWTYHQCRTDSQQPG
FLCEDRTTCLPPSLLCDGKMDCRDGWDEAAASCGQMPDSLPQNLIFKCPNQKTWTFVDRV
CDTRNDCGDCSDESVSRCPECSGWRCETVFFADCACIPRSRCRNGIQDCADWSDENLCD
Download sequence
Identical sequences ENSMUSP00000136875 ENSMUSP00000136875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]