SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005488 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000005488
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-63
Family Caspase catalytic domain 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005488   Gene: ENSMUSG00000005355   Transcript: ENSMUST00000005488
Sequence length 257
Comment pep:known chromosome:GRCm38:10:78711997:78718293:-1 gene:ENSMUSG00000005355 transcript:ENSMUST00000005488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDP
TAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDT
LHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSILELTEEITRLMANTEVMQEGKPR
KVNPEVQSTLRKKLYLQ
Download sequence
Identical sequences O89094 Q542Q1
ENSMUSP00000005488 10090.ENSMUSP00000005488 mmt008010878.1 ENSMUSP00000005488 ENSMUSP00000005488 NP_033939.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]