SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015511 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015511
Domain Number 1 Region: 52-548
Classification Level Classification E-value
Superfamily Sema domain 2.49e-99
Family Sema domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.14e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.000000000000042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.066
Further Details:      
 
Domain Number 4 Region: 889-980
Classification Level Classification E-value
Superfamily E set domains 0.000000000000108
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 1067-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000121
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000015511
Domain Number - Region: 1208-1259
Classification Level Classification E-value
Superfamily E set domains 0.0202
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.088
Further Details:      
 
Domain Number - Region: 709-747
Classification Level Classification E-value
Superfamily Plexin repeat 0.0641
Family Plexin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015511   Gene: ENSMUSG00000030123   Transcript: ENSMUST00000015511
Sequence length 1925
Comment pep:known chromosome:GRCm38:6:115954811:115995005:-1 gene:ENSMUSG00000030123 transcript:ENSMUST00000015511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRAAGGAPPSARAAAAVPLRPRPHSRGPGLLPLPLLLLLGAARAGALEIQRRFPSPTP
TNNFALDGTAGTVYLAAVNRLYQLSSANLSLEAEATVGPVPDSPLCHAPQLPQASCEHPR
RLTDNYNKILQLDPGQGLVVACGSIYQGLCQLRRRGNISALAVSFPPAAPTAEPVTVFPS
MLNVAANHPNASTVGLVLPPTSGTGGSRLLVGATYTGFGSAFFPRNRSLEDHRFENTPEI
AIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAVPPHSAQPYAY
LALNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRL
VSVFPAREQFFAVFERPQGAPGARNAPAALCAFRFDDVQAAIRAARTACFVEPAPDVVAV
LDSVVQGTGPACESKRNIQLQPEQLDCGAAHLQHPLTILQPLRASPVFRAPGLTAVAVAS
ANNYTAVFLGTATGRLLKISLNESMQVVSRRVLTVAYGEPVHHVMQFDPMDPGYLYLMTS
HQMARVKVAACEVHSTCGDCVGAADAYCGWCTLETRCTLQQDCTNSSQPHFWTSASEGPS
RCPAMTVLPSEIDVHRDYTGMILQISGSLPSLSGMEMACDYGNGVRTVARVPGPAYDHQI
AYCNLLPRAQFPSFPAGQDHVTVEMSVRVKGHNIVSANFTIYDCSRIGQVYPHTACTSCL
STQWPCSWCIQLHSCVSNQSQCQDSPNPTSPQDCPQILPSPLAPVPTGGSQDILVPLTKA
TFFHGSSLECSFGLEESFEAVWANNSLVRCNQVVLHTTQKSQVFPLSLKLKGPPDRFLDS
PNPMTVVVYNCAMGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLPGTCPAPEIRAIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLADRYTVSEEIVCATGPAAGAF
SDVVTVNVSKEGRSREQFSYVLPTVHSLEPSMGPKAGGTRITIHGSDLNVGSMLQVLVND
TDPCTDLTRTATSITCTVPGGTLPSPVPVCVRFESRGCVHGNLTFWYMQNPVITAISPGR
SPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTFCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADEAAEELLDPAEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLESHEYHIKIGQVSCDIQIISDRVIHCSVNESLGTAEGQLPITIQVGNFNQTI
ATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSKTLNS
QGGSPPQETHPLLGEWNIPEHCRPSMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYVL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDSTLGRVKDLDTEKYFHLVLPT
DELVEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKTVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIYE
CYSEA
Download sequence
Identical sequences Q3UH93
NP_080652.2.92730 ENSMUSP00000015511 ENSMUSP00000015511 ENSMUSP00000015511 10090.ENSMUSP00000015511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]