SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020822 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020822
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.97e-95
Family CAF1-like ribonuclease 0.00000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020822   Gene: ENSMUSG00000020515   Transcript: ENSMUST00000020822
Sequence length 292
Comment pep:known chromosome:GRCm38:11:58104153:58118594:1 gene:ENSMUSG00000020515 transcript:ENSMUST00000020822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDY
QYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSG
LQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHE
FFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFR
MKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAMINNMQQ
Download sequence
Identical sequences Q9D8X5
10090.ENSMUSP00000020822 354578 ENSMUSP00000020822 ENSMUSP00000104471 ENSMUSP00000020822 ENSMUSP00000020822 NP_081225.1.92730 XP_006534165.1.92730 XP_006534166.1.92730 XP_006534167.1.92730 XP_006534168.1.92730 XP_006534169.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]