SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028981 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028981
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-51
Family Calponin-homology domain, CH-domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-21
Family EB1 dimerisation domain-like 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028981   Gene: ENSMUSG00000027479   Transcript: ENSMUST00000028981
Sequence length 268
Comment pep:known chromosome:GRCm38:2:153741274:153773310:1 gene:ENSMUSG00000027479 transcript:ENSMUST00000028981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMV
RKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences Q3U4H0 Q61166
ENSMUSP00000028981 ENSMUSP00000028981 NP_031922.1.92730 10090.ENSMUSP00000028981 ENSMUSP00000028981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]