SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033738 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033738
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.98e-56
Family DnaQ-like 3'-5' exonuclease 0.00000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033738   Gene: ENSMUSG00000031372   Transcript: ENSMUST00000033738
Sequence length 236
Comment pep:known chromosome:GRCm38:X:73433705:73435344:-1 gene:ENSMUSG00000031372 transcript:ENSMUST00000033738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEPPRAETFVFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLPRVLDKL
TLCMCPERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEGPICLVAHNGF
DYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKSYSLASLFHRYF
QAEPSAAHSAEGDVHTLLLIFLHRAPELLAWADEQARSWAHIEPMYVPPDGPSLEA
Download sequence
Identical sequences Q3SXB3 Q9R1A9
NP_036037.1.92730 10090.ENSMUSP00000033738 ENSMUSP00000033738 ENSMUSP00000033738 ENSMUSP00000033738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]