SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033822 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033822
Domain Number 1 Region: 137-399
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-34
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 2 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 1.23e-23
Family GLA-domain 0.00048
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000963
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033822   Gene: ENSMUSG00000031445   Transcript: ENSMUST00000033822
Sequence length 399
Comment pep:known chromosome:GRCm38:8:13060908:13075006:1 gene:ENSMUSG00000031445 transcript:ENSMUST00000033822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCILLLRGFILTLILHQVELSVFLPAPKANNVLRRWRRGSSYFLEEIFQGNLEKECYE
EVCNYEEAREVFENDVITDEFWRQYGGGSPCVSQPCLNNGTCEDHIRSYSCTCSPGYEGK
TCAMAKNECHLERTDGCQHFCHPGQSSYMCSCAKGYKLGKDQKSCGPSDKCACGALTSEH
IRMTKSSQSQPSFPWQVRLTNSEGEDFCAGVLLQEDFVLTTAKCSLLHSNISVKANVDQR
IRIKSTHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLIPGTEGLLS
GWMLNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCEKGSVVMGPWVEGSVVTREH
KGTWFLTGILGSPPPPGQSQMLLLTAVPRYSMWFKQIMK
Download sequence
Identical sequences Q9CQW3
ENSMUSP00000033822 ENSMUSP00000033822 NP_080110.1.92730 ENSMUSP00000033822 10090.ENSMUSP00000033822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]