SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038901 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038901
Domain Number 1 Region: 182-436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-50
Family Voltage-gated potassium channels 0.0015
Further Details:      
 
Domain Number 2 Region: 19-128
Classification Level Classification E-value
Superfamily POZ domain 1.1e-24
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038901   Gene: ENSMUSG00000040164   Transcript: ENSMUST00000045196
Sequence length 497
Comment pep:known chromosome:GRCm38:2:164163619:164171113:-1 gene:ENSMUSG00000040164 transcript:ENSMUST00000045196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRLGRLQAAASEEQARRL
CDDYDAAAHEFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFGQEADYWGLGENALATC
CRARYLERRVARPRAWDEDSDAPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTME
NPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSAEEVRDDPV
LRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDQRG
ASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVS
VFSGVAYTAEEENEGFHTIPACWWWGTVSMTTVGYGDVVPETVGGKLAASGCILGGILVV
ALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLSSVDGVSDVSLETSRDTSQEGRS
TDLETQAPREPAKSHSY
Download sequence
Identical sequences O35173
ENSMUSP00000038901 ENSMUSP00000038901 10090.ENSMUSP00000038901 ENSMUSP00000038901 NP_032461.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]