SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044665 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044665
Domain Number 1 Region: 22-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.12e-44
Family Pentraxin (pentaxin) 0.0000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044665   Gene: ENSMUSG00000037942   Transcript: ENSMUST00000038495
Sequence length 225
Comment pep:known chromosome:GRCm38:1:172698056:172699966:1 gene:ENSMUSG00000037942 transcript:ENSMUST00000038495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLWCLLIMISFSRTFGHEDMFKKAFVFPKESDTSYVSLEAESKKPLNTFTVCLHFYT
ALSTVRSFSVFSYATKKNSNDILIFWNKDKQYTFGVGGAEVRFMVSEIPEAPTHICASWE
SATGIVEFWIDGKPKVRKSLHKGYTVGPDASIILGQEQDSYGGDFDAKQSLVGDIGDVNM
WDFVLSPEQISTVYVGGTLSPNVLNWRALNYKAQGDVFIKPQLWS
Download sequence
Identical sequences P14847
ENSMUSP00000044665 NP_031794.3.92730 ENSMUSP00000044665 10090.ENSMUSP00000044665 ENSMUSP00000044665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]