SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046532 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046532
Domain Number 1 Region: 49-138
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-28
Family SH2 domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 191-213,265-319
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-22
Family SH3-domain 0.0000352
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000135
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046532   Gene: ENSMUSG00000042351   Transcript: ENSMUST00000043149
Sequence length 322
Comment pep:known chromosome:GRCm38:15:80623505:80650559:1 gene:ENSMUSG00000042351 transcript:ENSMUST00000043149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFH
EGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPS
VNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGL
GSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSW
WTGRLHNKLGLFPANYVAPMMR
Download sequence
Identical sequences O89100 Q3U0E8
ENSMUSP00000046532 10090.ENSMUSP00000046532 NP_001276371.1.92730 NP_034945.1.92730 ENSMUSP00000046532 ENSMUSP00000046532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]