SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051303 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051303
Domain Number 1 Region: 303-435
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-50
Family ets domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 30-135
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.57e-35
Family Pointed domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051303   Gene: ENSMUSG00000032035   Transcript: ENSMUST00000050797
Sequence length 440
Comment pep:known chromosome:GRCm38:9:32696042:32757820:1 gene:ENSMUSG00000032035 transcript:ENSMUST00000050797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGR
ASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDAD
Download sequence
Identical sequences P27577 Q540Q5
ENSMUSP00000034534 10090.ENSMUSP00000034534 NP_035938.2.92730 ENSMUSP00000034534 ENSMUSP00000051303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]