SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000056621 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000056621
Domain Number 1 Region: 403-514
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-22
Family SH2 domain 0.00074
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000663
Family SAM (sterile alpha motif) domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000056621   Gene: ENSMUSG00000002699   Transcript: ENSMUST00000052413
Sequence length 534
Comment pep:known chromosome:GRCm38:11:34046920:34092295:1 gene:ENSMUSG00000002699 transcript:ENSMUST00000052413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGGWSSFEDDYESPNDDDP
DGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPPNSFHNTNSMYIDRPPTG
KVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRSGNNKTAKLPAPSIDRSTK
PPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQKPPLPPAMDRHERNERLGPV
TTRKPPVPRHGRGPDRRENDEDDVHQRPLPQPSLPSMSSNTFPSRSVQPSSKNTFPLAHM
PGAFSESNIGFQQSASLPPYFSQEGPGNRPPLRSEGRNLPLPVPNRPQPPSPGEEETPLD
EEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMVLYKDKVYNIQIRYQEE
SQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGCL
Download sequence
Identical sequences ENSMUSP00000056621 ENSMUSP00000056621 ENSMUSP00000056621 10090.ENSMUSP00000056621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]