SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060771 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060771
Domain Number 1 Region: 617-859
Classification Level Classification E-value
Superfamily VPS9 domain 9.68e-49
Family VPS9 domain 0.00079
Further Details:      
 
Domain Number 2 Region: 59-157
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000151
Family SH2 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060771   Gene: ENSMUSG00000044456   Transcript: ENSMUST00000056950
Sequence length 980
Comment pep:known chromosome:GRCm38:12:102283048:102390855:1 gene:ENSMUSG00000044456 transcript:ENSMUST00000056950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAEAPSSAHPAGPIPDAGKGEGEEDEEKDGTRLGLSTTPRNCIPRRGISVLEKLVKTC
PVWLQLGLGQAEAAKILQQEMAGMFLVCRDNNLKQLVLCVHFPSLKGSSAEVLEYPIKEE
KAILYLEGSVLVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFLELETISNLGLGFW
DSSLNSRGSAEPLRSPAPGTPASSSLRPTTHYANCSCEIELSVGNDRLWFVNPIFIEDCI
LPADPPPLPTGSYPPRPTPATPDATSPTSKGSPRRPPPPPPLPTVPPTGPARPLAPPVPP
AGPLPNSPLTPTSHLAPHAPGPPGHSNQPPMTACESLPRPAVGLGPFGEEEMKPGTTPNP
LHQAPPPPLPLKKALPAAPPRRRISERVSLESQNVGTSTDRDHSGISRTASLNLPPQSTV
SSLGDRPPRTTEQSQDTEAKASHADSIPVPPGKAKQPPVPPPRKKRVSRQLASTLLSPLE
SPIQEASSEKQATGASWEGLSPVRQAGMQHLQVQSSSCPQSSPEFKGSQASLSDSLGVPA
SAADQDSYSTSSAEEELEFSSPNVKKKPSMILDKARHRLSFVSFASVFHAFLSSDRKLYK
KVVELAQDKSSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTELKA
LVEPTLHSEEELEAIVESALYKCVLKPLKEAINSSLLEIHSRDGSLQQLKENQLVVLATT
TTDLGVTTSVPEVAVMEKILQKLTSMHKAYSPGKKISILLKTCKLIYDSMALGNPGKPYG
ADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKNYDKI
TVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLKPEQQSRTLASRADTAAQ
ALCAQCAEKFEVSQPQDYRLFVLVDGRCFQLADEALPHRIKGYLLRSEPKRDFHFVYRPQ
DSGKDASSQPCIVVREPNFL
Download sequence
Identical sequences P59729
NP_808288.2.92730 10090.ENSMUSP00000060771 ENSMUSP00000060771 ENSMUSP00000060771 ENSMUSP00000060771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]